PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA07g17430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 448aa    MW: 50964 Da    PI: 6.3346
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA07g17430genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.71.8e-171769557
                SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                 ++++eq++ Le+ F +++++  e++ +L+k+lg++ rq+++W+qNrRa++k+
  CA07g17430 17 KRLNQEQVKLLEASFDSTKKLELEKKLQLSKELGVPPRQISIWYQNRRARWKN 69
                5689***********************************************95 PP

2HD-ZIP_I/II97.81.1e-3115106293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +k+rl++eqvklLE sF++++kLe e+K +l++eLg+ prq+ +W+qnrRAR+k+++lE+dy+aL+ ++++  +e+ +Leke+e Lr el++
   CA07g17430  15 NKKRLNQEQVKLLEASFDSTKKLELEKKLQLSKELGVPPRQISIWYQNRRARWKNQNLENDYNALQLKLENALSEKMQLEKETEFLRGELQR 106
                  69*************************************************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.4351070IPR001356Homeobox domain
SMARTSM003894.8E-141474IPR001356Homeobox domain
SuperFamilySSF466895.56E-161678IPR009057Homeodomain-like
PfamPF000468.1E-151669IPR001356Homeobox domain
CDDcd000863.04E-131671No hitNo description
Gene3DG3DSA:1.10.10.601.6E-181777IPR009057Homeodomain-like
PROSITE patternPS0002704568IPR017970Homeobox, conserved site
PfamPF117894.9E-13341403IPR004181Zinc finger, MIZ-type
Gene3DG3DSA:3.30.40.102.4E-6356402IPR013083Zinc finger, RING/FYVE/PHD-type
SuperFamilySSF578501.41E-6356404No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006974Biological Processcellular response to DNA damage stimulus
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0010082Biological Processregulation of root meristem growth
GO:0016925Biological Processprotein sumoylation
GO:0032876Biological Processnegative regulation of DNA endoreduplication
GO:0045931Biological Processpositive regulation of mitotic cell cycle
GO:0060250Biological Processgerm-line stem-cell niche homeostasis
GO:0080038Biological Processpositive regulation of cytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0008270Molecular Functionzinc ion binding
GO:0019789Molecular FunctionSUMO transferase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MNSSFNSQNL QKYPNKKRLN QEQVKLLEAS FDSTKKLELE KKLQLSKELG VPPRQISIWY  60
QNRRARWKNQ NLENDYNALQ LKLENALSEK MQLEKETEFL RGELQRANEM LIAINSGAQG  120
QIREFSLSSS CCDQDVVSYT STTWVHTDHE VNYNLQFDEL YAMIGVEEGS NKCYSTCKLK  180
LNNLRPNDAV KPSKWRRRPX XXGSGGVATG RIRSTTSALY SDSQSLLREI RKSIAMMKDI  240
AVELERDERK EMVKELEDGV VQLLAASDDC MHLSEAIQSI GDEIEPGPEP TNFKKKFDEE  300
IAKSKARSSS HAQNQSLLRQ FREAIWHVHH AGQPLPGDEQ EDIVMTSTQC NLLNVTCPLS  360
GKPVTELAEP VRSMDCKHIY EKKTIMQYLK SKTSRGQCPV AGCPKILKAQ RVLCDPFLLI  420
EIDELMSTSK QNRPDAIEDF TVLDDED*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754461e-130HG975446.1 Solanum pennellii chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016579531.10.0PREDICTED: E3 SUMO-protein ligase MMS21
SwissprotQ8GYH73e-90NSE2_ARATH; E3 SUMO-protein ligase MMS21
TrEMBLM1AXC61e-157M1AXC6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000323881e-156(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1074322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.15e-20homeobox protein 52